#pranayama

339,080 posts

Loading...
💙💙💙
⠀
Day 19: #JalandaraBandha | #ChinLock | #Vishuddha Chakra #Throat⠀@yogaonhigh #yohimagic #chakratastic #doublepigeon #agnistambhasana #atomiclove #noperfectpeopleallowed #yogaeverydamnday #yoga #lifeisgood #igyoga #chakra #challenge #yoga #meditation #philosophy #asana #pranayama #prana #radiance #beauty #wellness #columbus #ohio #614yoga #cbus #asseenincolumbus

⠀ Day 19: #JalandaraBandha | #ChinLock | #Vishuddha Chakra #Throat@yogaonhigh #yohimagic #chakratastic #doublepigeon #agnistambhasana #atomiclove #noperfectpeopleallowed #yogaeverydamnday #yoga #lifeisgood #igyoga #chakra #challenge #yoga #meditation #philosophy #asana #pranayama #prana #radiance #beauty #wellness #columbus #ohio #614yoga #cbus #asseenincolumbus - 5 hours ago

9 Likes
0 Comments
0
Hey Yogis :) I will see you guys on Thursday at Spring Fitness for Gentle Yoga at 11:15am. Namaste 🙏
#yoga #meditation #hatha #balance #mindbody #vacation #californialove #letsmove #pranayama #goodthingscoming

Hey Yogis :) I will see you guys on Thursday at Spring Fitness for Gentle Yoga at 11:15am. Namaste #yoga #meditation #hatha #balance #mindbody #vacation #californialove #letsmove #pranayama #goodthingscoming - 5 hours ago

12 Likes
1 Comments
0
Loading...
Mum’s and Bub’s Yoga this morning at Twine ✨
With so much emphasis on pregnancy and labour, the post partum period is often neglected and undervalued. This weekly 60 minute class goes beyond being a class with baby by your side. It is specifically for new mums to aid post partum recovery, both physically and mentally.
This offering will support strength building, restoration, rest, breath work, mindfulness, confidence, and connection.
-
Drop in passes or 5 packs available.
-
#twineyogastudio #twine #twinetime #newcastleyoga #newcastle #yogateacher #newcastleyogastudio #adamstown #adamstownyoga #hatha #vinyasa #yin #beginnersyoga #restorative #meditation #workshops #health #breathe #energy #balance #pranayama #asana #selfcare #selflove #mindfulness #gratitude #relaxation #postpartum #mumsandbubs #mother

Mum’s and Bub’s Yoga this morning at Twine With so much emphasis on pregnancy and labour, the post partum period is often neglected and undervalued. This weekly 60 minute class goes beyond being a class with baby by your side. It is specifically for new mums to aid post partum recovery, both physically and mentally. This offering will support strength building, restoration, rest, breath work, mindfulness, confidence, and connection. - Drop in passes or 5 packs available. - #twineyogastudio #twine #twinetime #newcastleyoga #newcastle #yogateacher #newcastleyogastudio #adamstown #adamstownyoga #hatha #vinyasa #yin #beginnersyoga #restorative #meditation #workshops #health #breathe #energy #balance #pranayama #asana #selfcare #selflove #mindfulness #gratitude #relaxation #postpartum #mumsandbubs #mother - 5 hours ago

6 Likes
0 Comments
0
Beautiful souls! Here is a post for the  beginning of a new week. Be strong! Soar on & don’t feel tired! Don’t be sad its Sunday, be excited for a new week ahead—full of miracles and wonders & the promise of God. I pray all of us will have Divine Eyes and be able to see how God works in our lives this week.

Beautiful souls! Here is a post for the beginning of a new week. Be strong! Soar on & don’t feel tired! Don’t be sad its Sunday, be excited for a new week ahead—full of miracles and wonders & the promise of God. I pray all of us will have Divine Eyes and be able to see how God works in our lives this week. - 5 hours ago

7 Likes
2 Comments
0
It rarely happens, but I woke up today with heavy thoughts and a heavy heart. Thank f*ck for my morning routine. Even when the illusion of security is ripped from beneath my feet, I always wake up with the same routine - it needs no accessory or external aid. Pranayama - 3 big #ujjayi breaths to bring me into the present moment and to bring my body into the parasympathetic nervous system - a state of rest and digest.  Then to energize myself, no matter how sleepless I am, I practice #oxygenflooding by. Getting as much oxygen into my lungs as quickly as possible via my mouth. Then I drink almost a litre of water, and I’m ready to take on the day. .
.
.
.
.
.
.
What’s your morning routine?
Are you well rested?
Are you hydrated? .
.
.
.
.
.
.
.
.
#pranayama #breathe #highperformance

It rarely happens, but I woke up today with heavy thoughts and a heavy heart. Thank f*ck for my morning routine. Even when the illusion of security is ripped from beneath my feet, I always wake up with the same routine - it needs no accessory or external aid. Pranayama - 3 big #ujjayi breaths to bring me into the present moment and to bring my body into the parasympathetic nervous system - a state of rest and digest. Then to energize myself, no matter how sleepless I am, I practice #oxygenflooding by. Getting as much oxygen into my lungs as quickly as possible via my mouth. Then I drink almost a litre of water, and I’m ready to take on the day. . . . . . . . What’s your morning routine? Are you well rested? Are you hydrated? . . . . . . . . . #pranayama #breathe #highperformance - 5 hours ago

7 Likes
0 Comments
0
Oh hey there Monday 👋🏼 brand new day + a brand new week!!
.
Moving up to our Third Eye, Ajna get ready to listen to that inner you.. 🙏🏼
.
Monday offerings
.
9:15am Foundations with Amanda -with a focus on breath, alignment, deeply connecting with body mind & soul we will explore key foundational asanas. Great for beginners & plenty of modifications for the seasoned yogi.
.
11am Soul Explore with Amanda
-Over 50’s
.
5:30pm Introduction to YOGA - Beginners course with Anita

Oh hey there Monday 🏼 brand new day + a brand new week!! . Moving up to our Third Eye, Ajna get ready to listen to that inner you.. 🏼 . Monday offerings . 9:15am Foundations with Amanda -with a focus on breath, alignment, deeply connecting with body mind & soul we will explore key foundational asanas. Great for beginners & plenty of modifications for the seasoned yogi. . 11am Soul Explore with Amanda -Over 50’s . 5:30pm Introduction to YOGA - Beginners course with Anita - 5 hours ago

4 Likes
1 Comments
0
Had a quick yoga practice today. Even 15 mins does wonders. #namaste #malasana #asana #pranayama #yoga

Had a quick yoga practice today. Even 15 mins does wonders. #namaste #malasana #asana #pranayama #yoga - 5 hours ago

11 Likes
1 Comments
0
Online saxophone lessons are a positive way to improve our environment ! It teaches us to listen, to respond, and to learn to love the temporary road to lasting eternal growth as a loving, focused, and person who is dedicated to positivity.

Online saxophone lessons are a positive way to improve our environment ! It teaches us to listen, to respond, and to learn to love the temporary road to lasting eternal growth as a loving, focused, and person who is dedicated to positivity. - 5 hours ago

11 Likes
1 Comments
0
#hathayoga #pranayama #iloveyoga

#hathayoga #pranayama #iloveyoga - 5 hours ago

2 Likes
0 Comments
0
This is the real secret of life - to be completely engaged with what you are doing in the here and now. And instead of calling it work, realize it is play.
•
Have you ever gone away for a week on a completely immersive experience? One where you feel so in the moment that you forget about your phone and worrying about what everyone else back home is doing because there is no where else you’d rather be?
•
Take an Adzenture:
🌊 Iceland, Sept. 20-26 2018
🌊 Peru, April 2-9 and 13-20 2019
🌊 more 2019 dates soon!

This is the real secret of life - to be completely engaged with what you are doing in the here and now. And instead of calling it work, realize it is play. • Have you ever gone away for a week on a completely immersive experience? One where you feel so in the moment that you forget about your phone and worrying about what everyone else back home is doing because there is no where else you’d rather be? • Take an Adzenture: Iceland, Sept. 20-26 2018 Peru, April 2-9 and 13-20 2019 more 2019 dates soon! - 6 hours ago

28 Likes
2 Comments
0
Don’t let Monday force you into a bind, unless you want it to!
.
.
What is binding in yoga?
Binding  involves linking the body (can be hands, foot, torso etc) in a posture. This link causes the body to be "bound" and held as a container, and therefore constricted in some way.
Binds physically deepen the pose and its effects, whether it’s for greater rotation (I.e. Bound Extended Side Angle) a fuller fold (like Bound Forward Fold), or a deep backbend and hip opener (I.e. King Pigeon). Binds offer another way to approach alignment by encouraging you to make self-adjustments to make the pose work. Plus binding can simply offer fun, creative variations on the classic poses. 
Remember! Be honest about where you are by practicing ahimsa (non-violence) by being gentle with yourself. Listen to your body and practice what feels good for YOU not what you see others practice. 
#riksha #yoga #scoresbyyoga #scoresby #yogatherapy #fitness #health #breath #prana #flow #vinyasa #hatha #meditation #ashtanga #beyourself #melbourne #melbourneyoga #yogaclasses #practice #pranayama #yogacommunity #practice

Don’t let Monday force you into a bind, unless you want it to! . . What is binding in yoga? Binding involves linking the body (can be hands, foot, torso etc) in a posture. This link causes the body to be "bound" and held as a container, and therefore constricted in some way. Binds physically deepen the pose and its effects, whether it’s for greater rotation (I.e. Bound Extended Side Angle) a fuller fold (like Bound Forward Fold), or a deep backbend and hip opener (I.e. King Pigeon). Binds offer another way to approach alignment by encouraging you to make self-adjustments to make the pose work. Plus binding can simply offer fun, creative variations on the classic poses. Remember! Be honest about where you are by practicing ahimsa (non-violence) by being gentle with yourself. Listen to your body and practice what feels good for YOU not what you see others practice. #riksha #yoga #scoresbyyoga #scoresby #yogatherapy #fitness #health #breath #prana #flow #vinyasa #hatha #meditation #ashtanga #beyourself #melbourne #melbourneyoga #yogaclasses #practice #pranayama #yogacommunity #practice - 6 hours ago

13 Likes
0 Comments
0
🙏🏼
Feeling sensations of gratitude for all my privileges in this life, and giggling at how easily and continually I can get caught up in the external ... all just concepts ... 😜
#HowHumanOfMe
✨✨✨✨✨✨✨✨✨✨✨✨
Restorative Yoga 1 on tonight 5.15-6.45pm
Text me to book your spot 0405 132 432
✨✨✨✨✨✨✨✨✨✨✨✨
#PureLiYoga
#RestorativeYoga
#InnerResource
#Pranayama
#Meditation
#AnxietyRelief

🏼 Feeling sensations of gratitude for all my privileges in this life, and giggling at how easily and continually I can get caught up in the external ... all just concepts ... #HowHumanOfMe Restorative Yoga 1 on tonight 5.15-6.45pm Text me to book your spot 0405 132 432 #PureLiYoga #RestorativeYoga #InnerResource #Pranayama #Meditation #AnxietyRelief - 6 hours ago

5 Likes
0 Comments
0
Y O G A práticas ao ar livre ou na sua casa, aulas particulares e personalizadas.  Saúde,  equilibrio emocional,  paz interior,  mente calma, bem-estar e longevidade.  Personal yoga, agende um horário inbox e venha experimentar.
#yogimiguel #yoga #yogadiet #yogaaoarlivre #yogaworkout #govegan #dietayogi #vegetariano #naturalmedicine #nonviolence #ahimsa #satya #pranayama #antistresse #antiagain #saúde #beleza #longevidade #Namasté

Y O G A práticas ao ar livre ou na sua casa, aulas particulares e personalizadas. Saúde, equilibrio emocional, paz interior, mente calma, bem-estar e longevidade. Personal yoga, agende um horário inbox e venha experimentar. #yogimiguel #yoga #yogadiet #yogaaoarlivre #yogaworkout #govegan #dietayogi #vegetariano #naturalmedicine #nonviolence #ahimsa #satya #pranayama #antistresse #antiagain #saúde #beleza #longevidade #Namasté - 6 hours ago

10 Likes
0 Comments
0
One to one Yoga classes are  a great way to start Yoga, if you need some attention focusing on a certain thing like back care, upper body strength, core strength, inversions, flexibility, your spiritual journey etc. 
_____________________
Perfect for total beginners, for someone with an injury, for anxiety or if you just don’t want to attend a class environment. 
_____________________
I offer a variety of one to one classes from the Blueberry Soul Centre. Get in contact for a chat, availability & bookings. ✉️ yoga@blueberrysoul.ie
📞 Rachel on 0862280436

One to one Yoga classes are  a great way to start Yoga, if you need some attention focusing on a certain thing like back care, upper body strength, core strength, inversions, flexibility, your spiritual journey etc. _____________________ Perfect for total beginners, for someone with an injury, for anxiety or if you just don’t want to attend a class environment. _____________________ I offer a variety of one to one classes from the Blueberry Soul Centre. Get in contact for a chat, availability & bookings. ️ yoga@blueberrysoul.ie Rachel on 0862280436 - 6 hours ago

26 Likes
1 Comments
0
Respira consciencia... a través de la respiración creamos un ritmo perfecto interior que nos brinda paz, sanación y armonía. #pranayama #salud #prana #meditación #mantra #bienestar #wellness #healtyfood #yoga #armonía #hábitos #recetas #naametabolic #veganrecipes #detox

Respira consciencia... a través de la respiración creamos un ritmo perfecto interior que nos brinda paz, sanación y armonía. #pranayama #salud #prana #meditación #mantra #bienestar #wellness #healtyfood #yoga #armonía #hábitos #recetas #naametabolic #veganrecipes #detox - 6 hours ago

18 Likes
1 Comments
0
DAY 19: |Jalandara Banda| Chin Lock |Visuddha Chakras| Throat Chakra❤️. Yes I’m open and Listening my dear feminine divine, my beautiful lineage of strong feminine who survived, are strong, powerful and  Goddesses......but can you speak a little slower...or bless me with a quickening so that I can keep up with ALL THE THINGS!  Delish!!! So many things arriving and revealing for my throat and third eye! #goddesslineage  CHAKRATASTIC CHALLENGE 31 days of of exploration of subtle-ness. 
tagging: @yogaonhigh #yohimagic #chakratastic. .
.
.
#chakra #challenge #yoga #meditation #philosophy #asana #pranayama #prana #radiance #beauty #wellness #columbus #ohio #614yoga #cbus #asseeninc olumbus @yogaonhigh @ohyogisofcolor

DAY 19: |Jalandara Banda| Chin Lock |Visuddha Chakras| Throat Chakra️. Yes I’m open and Listening my dear feminine divine, my beautiful lineage of strong feminine who survived, are strong, powerful and Goddesses......but can you speak a little slower...or bless me with a quickening so that I can keep up with ALL THE THINGS! Delish!!! So many things arriving and revealing for my throat and third eye! #goddesslineage CHAKRATASTIC CHALLENGE 31 days of of exploration of subtle-ness. tagging: @yogaonhigh #yohimagic #chakratastic . . . . #chakra #challenge #yoga #meditation #philosophy #asana #pranayama #prana #radiance #beauty #wellness #columbus #ohio #614yoga #cbus #asseeninc olumbus @yogaonhigh @ohyogisofcolor - 6 hours ago

13 Likes
1 Comments
0
#checkyourchakras #rootchakra #muladhara #grounded #iam #mantra #yoga #yogalife #breathe #pranayama #om #gong #omg #ommygong #gongpractitioner #soundmeditation sessions begin #august #2018 #fullmoon

#checkyourchakras #rootchakra #muladhara #grounded #iam #mantra #yoga #yogalife #breathe #pranayama #om #gong #omg #ommygong #gongpractitioner #soundmeditation sessions begin #august #2018 #fullmoon - 6 hours ago

8 Likes
0 Comments
0
Outings with the bear 🌞
I decided to break up with the idea of having a structured IG feed (food photos in one column, or whatever). The truth is my life is not that organized! The most structure comes from taking care of this guy, because he needs it. I very rarely think of capturing my asana practice, and some days that practice is like 3 postures and mainly pranayama and trying to organize the shit bouncing around in my head. So sometimes I might mostly share food and dog pictures. No reason trying to fight it. Such is life 💁‍♀️
...
...
...
...
...
...
#dogmom #huskymom #pnw #yogateacherlife #lifeisgood #asana #pranayama #dogfamily

Outings with the bear 🌞 I decided to break up with the idea of having a structured IG feed (food photos in one column, or whatever). The truth is my life is not that organized! The most structure comes from taking care of this guy, because he needs it. I very rarely think of capturing my asana practice, and some days that practice is like 3 postures and mainly pranayama and trying to organize the shit bouncing around in my head. So sometimes I might mostly share food and dog pictures. No reason trying to fight it. Such is life ‍♀️ ... ... ... ... ... ... #dogmom #huskymom #pnw #yogateacherlife #lifeisgood #asana #pranayama #dogfamily - 6 hours ago

14 Likes
1 Comments
0
@robharris29 no one understands this but us 🤷🏻‍♀️ #itsfunnybecauseitstrue #peanutbutter #yoga #yogi #yogalifestyle #yogainspiration #namaste #shanti #santosha #prana #pranayama #nutrition #gym #intuitiveeating #edrecovery #edawareness #npdabuserecovery #npdawarnessarndvictimrecovery #happy

@robharris29 no one understands this but us 🤷🏻‍♀️ #itsfunnybecauseitstrue #peanutbutter #yoga #yogi #yogalifestyle #yogainspiration #namaste #shanti #santosha #prana #pranayama #nutrition #gym #intuitiveeating #edrecovery #edawareness #npdabuserecovery #npdawarnessarndvictimrecovery #happy - 6 hours ago

22 Likes
2 Comments
0
Completed season 2 of this show about Swami Ramdev. Very interesting...looking forward to season 3
#yogi #yoga #ayurveda
#lifestories #netflix #moviescraftyhippiechickwatched #movieslisawatched #serieslisawatched #seriescraftyhippiechickwatched #pranayama

Completed season 2 of this show about Swami Ramdev. Very interesting...looking forward to season 3 #yogi #yoga #ayurveda #lifestories #netflix #moviescraftyhippiechickwatched #movieslisawatched #serieslisawatched #seriescraftyhippiechickwatched #pranayama - 6 hours ago

4 Likes
1 Comments
0
Had 5 days off from teaching, but I’m back at it tomorrow!

Find me this week @purebalanceyogabathurst !
Monday: 4:45 Gentle Hot
Tuesday: 9:30 Gentle Strength Building
Wednesday: 6:00 Hot Flow
Thursday: 4:45 Mind Body Balance (Yoga, Pranayama, & Meditation)
Saturday: 10:00 Core Yoga & 11:30 Vin & Yin

Hope to see you on your mat!

#meme #m-eh-m #yogamemes #bathurstnb #yoga #meditation #pranayama #dancerspose

Had 5 days off from teaching, but I’m back at it tomorrow! Find me this week @purebalanceyogabathurst ! Monday: 4:45 Gentle Hot Tuesday: 9:30 Gentle Strength Building Wednesday: 6:00 Hot Flow Thursday: 4:45 Mind Body Balance (Yoga, Pranayama, & Meditation) Saturday: 10:00 Core Yoga & 11:30 Vin & Yin Hope to see you on your mat! #meme #m -eh-m #yogamemes #bathurstnb #yoga #meditation #pranayama #dancerspose - 6 hours ago

14 Likes
1 Comments
0
Day 19: Jaladhara Bandha | Vishuddha Chakra | Throat .
• • •
Pause. Breathe. Reflect. Love. Be. Speak. ✨
• • •
#yohimagic #chakratastic #chakra #challenge #yoga #meditation #philosophy #asana #pranayama #prana #radiance #beauty #wellness #columbus #ohio #614yoga #419yoga #cbus #asseenincolumbus @yogaonhigh

Day 19: Jaladhara Bandha | Vishuddha Chakra | Throat . • • • Pause. Breathe. Reflect. Love. Be. Speak. • • • #yohimagic #chakratastic #chakra #challenge #yoga #meditation #philosophy #asana #pranayama #prana #radiance #beauty #wellness #columbus #ohio #614yoga #419yoga #cbus #asseenincolumbus @yogaonhigh - 6 hours ago

22 Likes
2 Comments
0
Y O G A. para todos.
Aulas particulares e personalizadas.  Mente calma, paz interior, Saúde,  bem-estar e longevidade.  Agende um horário. Inbox.
#yoga #ashatangayoga #hatta #flexibilidade #equilibriio #ahimsa #pranayama #meditaçao #dietayogi #naturalfood #vegetariano #buddhawarrior #yogimiguel #Namasté

Y O G A. para todos. Aulas particulares e personalizadas. Mente calma, paz interior, Saúde, bem-estar e longevidade. Agende um horário. Inbox. #yoga #ashatangayoga #hatta #flexibilidade #equilibriio #ahimsa #pranayama #meditaçao #dietayogi #naturalfood #vegetariano #buddhawarrior #yogimiguel #Namasté - 6 hours ago

8 Likes
1 Comments
0
Day 19: Jalandara Bandha | Chin Lock | Vishiddha Chakra | Throat 
iPhones and water don’t mix, but the pose of the day was def my bff on those antigravity waterslides. 🤙🏽 @yogaonhigh #yohimagic #chakratastic #chakra #challenge #yoga #meditation #philosphy #asana #chinlock #jalandarabandha #waterslides #defygravity #adrenaline #energy #pranayama #throatchakra #vishiddha #yogaonvacation

Day 19: Jalandara Bandha | Chin Lock | Vishiddha Chakra | Throat iPhones and water don’t mix, but the pose of the day was def my bff on those antigravity waterslides. 🤙🏽 @yogaonhigh #yohimagic #chakratastic #chakra #challenge #yoga #meditation #philosphy #asana #chinlock #jalandarabandha #waterslides #defygravity #adrenaline #energy #pranayama #throatchakra #vishiddha #yogaonvacation - 7 hours ago

5 Likes
0 Comments
0
Allow yourself to breathe.
Allow yourself to rest.
Allow yourself to heal. ----------------------------------------------------------------------- One of my favorite ways to recharge is to sit in the sunshine, close or soften my eyes and just focus on the breath. Inhale to expand. Exhale to contract. Slow the breath down to really explore this interplay. Letting the breath drop into my belly and slowly deepen.

It feels so good to breathe deeply.

Sometimes this is a one minute practice and sometimes it's a ten minute practice. The key is returning to it often and allowing yourself to recharge as often as you need. .
.

How do you recharge? .
.
.
📸 @ebuya

Allow yourself to breathe. Allow yourself to rest. Allow yourself to heal. ----------------------------------------------------------------------- One of my favorite ways to recharge is to sit in the sunshine, close or soften my eyes and just focus on the breath. Inhale to expand. Exhale to contract. Slow the breath down to really explore this interplay. Letting the breath drop into my belly and slowly deepen. It feels so good to breathe deeply. Sometimes this is a one minute practice and sometimes it's a ten minute practice. The key is returning to it often and allowing yourself to recharge as often as you need. . . How do you recharge? . . . 📸 @ebuya - 7 hours ago

62 Likes
3 Comments
0
Just a reminder that progress comes as a result of making small, seemingly inconsequential choices and investments, day by day by day, until one day you wake up and you barely recognize the person in the mirror who can do all the amazing things you can do. ✨ Here’s where you can practice yoga with me in Nashville this week:
.
M O N D A Y  8 / 2 0
4:30PM Northwest YMCA
.
T U E S D A Y  8 / 2 1
8:30AM Maryland Farms YMCA
11:00AM Green Hills YMCA
.
W E D N E S D A Y  8 / 2 2
9:45AM (Chair Yoga) Maryland Farms YMCA
4:30PM Corporate Event
7:00PM Nashville Athletic Club
.
T H U R S D A Y  8 / 2 3
8:00AM Green Hills YMCA
9:30AM Green Hills YMCA
.
F R I D A Y  8 / 2 4
4:30PM 🔥hot🔥 @kali.yuga.yoga .
.
#yoga #yogagram #instayoga #nashville #nashvilleyoga #asana #pranayama #breathe #meditate #yogaeverydamnday #pinchaprogressreport

Just a reminder that progress comes as a result of making small, seemingly inconsequential choices and investments, day by day by day, until one day you wake up and you barely recognize the person in the mirror who can do all the amazing things you can do. Here’s where you can practice yoga with me in Nashville this week: . M O N D A Y 8 / 2 0 4:30PM Northwest YMCA . T U E S D A Y 8 / 2 1 8:30AM Maryland Farms YMCA 11:00AM Green Hills YMCA . W E D N E S D A Y 8 / 2 2 9:45AM (Chair Yoga) Maryland Farms YMCA 4:30PM Corporate Event 7:00PM Nashville Athletic Club . T H U R S D A Y 8 / 2 3 8:00AM Green Hills YMCA 9:30AM Green Hills YMCA . F R I D A Y 8 / 2 4 4:30PM hot @kali.yuga.yoga . . #yoga #yogagram #instayoga #nashville #nashvilleyoga #asana #pranayama #breathe #meditate #yogaeverydamnday #pinchaprogressreport - 7 hours ago

45 Likes
2 Comments
0
Whether it’s your 1st class or your 500th, we’re (Here) for you. We offer a space to practice mindful movement, conscious breath, and presence. So whether your goal is to bend backwards or to be a little kinder, come join our community and be more (Here).

Whether it’s your 1st class or your 500th, we’re (Here) for you. We offer a space to practice mindful movement, conscious breath, and presence. So whether your goal is to bend backwards or to be a little kinder, come join our community and be more (Here). - 7 hours ago

33 Likes
1 Comments
0
#yogaworkshop #chakras #pranayama #eightlimbsofyoga #Apeldoorn #tentijesport #sundaymorning

#yogaworkshop #chakras #pranayama #eightlimbsofyoga #Apeldoorn #tentijesport #sundaymorning - 7 hours ago

0 Likes
0 Comments
0
Practicing different pranayamas with my Kula! Which is your favorite pranayama?
-
-
-
-
#prana #yama #pranayama #breathe #breath #breathwork #energy #healing #energywork #kula #family #yoga #yogafamily #meditation #yogi #yoginis #ytt #yogateacher #yogateachers #lotuspose #om #namaste #learn #spirituality #yogaeverydamnday #sacredspace #costarica #puertorviejo #shala #mahashala

Practicing different pranayamas with my Kula! Which is your favorite pranayama? - - - - #prana #yama #pranayama #breathe #breath #breathwork #energy #healing #energywork #kula #family #yoga #yogafamily #meditation #yogi #yoginis #ytt #yogateacher #yogateachers #lotuspose #om #namaste #learn #spirituality #yogaeverydamnday #sacredspace #costarica #puertorviejo #shala #mahashala - 7 hours ago

37 Likes
2 Comments
0
"Worrying is like walking around with an umbrella waiting for it to rain." #yoga  #class #workout #meditation  #teacher #time #weightloss #yogateacher #week #yogaposes #mat  #morning #body #power #relaxing #mindfulness #soulecting #prayer #self #guidedmeditation #pranayama #yoganidra #yogaRetreats #meditationretreats #Nepalyogaretreat #spirituality #cultural #Baliyogaretreat

"Worrying is like walking around with an umbrella waiting for it to rain." #yoga #class #workout #meditation #teacher #time #weightloss #yogateacher #week #yogaposes #mat #morning #body #power #relaxing #mindfulness #soulecting #prayer #self #guidedmeditation #pranayama #yoganidra #yogaRetreats #meditationretreats #Nepalyogaretreat #spirituality #cultural #Baliyogaretreat - 7 hours ago

23 Likes
2 Comments
0
Today was magnificent. Strong breath filled practice. Inspiring! #yoga #pranayama #yogateachers #yogastudents #yogateachertraining #northfork

Today was magnificent. Strong breath filled practice. Inspiring! #yoga #pranayama #yogateachers #yogastudents #yogateachertraining #northfork - 7 hours ago

16 Likes
0 Comments
0
Join us this evening at 5pm @tiachuchas . Coming off a long week of work and transitions; a good session of sustained postures, movement and breath work is in order. Let's get ourselves ready for the new week. See you soon!
-
-
-
#sylmaryoga #tiachuchas #asana #pranayama #healthandwellness #yoganuestra #luzenyoga #sfvyoga

Join us this evening at 5pm @tiachuchas . Coming off a long week of work and transitions; a good session of sustained postures, movement and breath work is in order. Let's get ourselves ready for the new week. See you soon! - - - #sylmaryoga #tiachuchas #asana #pranayama #healthandwellness #yoganuestra #luzenyoga #sfvyoga - 7 hours ago

11 Likes
0 Comments
0
#shakti #shaktiflow #divinefeminine #innerg #prana #pranayama  #breath

#shakti #shaktiflow #divinefeminine #innerg #prana #pranayama #breath - 7 hours ago

13 Likes
1 Comments
0
In Quantum Physics, the paradox in this picture - of right hand drawing the left and left drawing the right, is referred to as Tangled Hierarchy. It shows that we need to remove ourselves from the apparent reality, taking a step back to realise, in this case, that in fact it was Escher drawing both hands. ✏️
.
You can not solve a problem from within the problem. You can park it. You can bury it and not look at it anymore, but you can only resolve a problem by rising above it to see the greater perspective. .
...enter the work I do. .
I have workshops coming up so I can teach people the HOW. HOW to step back, HOW to broaden your perspective. It's a formula, essentially, which means it's replicable. Learn it once and apply it for life. First workshop coming up is in #Napier, New Zealand in March 2019.

In Quantum Physics, the paradox in this picture - of right hand drawing the left and left drawing the right, is referred to as Tangled Hierarchy. It shows that we need to remove ourselves from the apparent reality, taking a step back to realise, in this case, that in fact it was Escher drawing both hands. ️ . You can not solve a problem from within the problem. You can park it. You can bury it and not look at it anymore, but you can only resolve a problem by rising above it to see the greater perspective. . ...enter the work I do. . I have workshops coming up so I can teach people the HOW. HOW to step back, HOW to broaden your perspective. It's a formula, essentially, which means it's replicable. Learn it once and apply it for life. First workshop coming up is in #Napier , New Zealand in March 2019. - 7 hours ago

33 Likes
5 Comments
0
#boanoite 🌎
✨ “As posturas do Yoga não são o objetivo. Tornar-se flexível não é o objetivo. 
Equilibrar-se sobre as mãos não é o objetivo.O objetivo é criar espaço nos lugares onde você uma vez era travado. É dissolver as camadas de proteção e defesa que você criou em torno do seu coração. 
É apreciar e reverenciar o seu corpo e tornar-se consciente dos seus estados mentais e do barulho produzido pela mente.
É ficar em paz com quem você é. O objetivo é amar. Amar você!

Vá para o seu tapetinho para sentir, não para fazer.

Mude o seu foco e seu coração expandirá!” Texto de Rachel Brathen

#namaste #asanas #yogabrasil #yogi #meditação #respiração #pranayama #amamosyoga #yoga #posturasyoga #gratitude #loveyoga #despertardivino  #yogaday #mundozen #yogi #meditabrasil #yogini #goodvibes  #yogaphoto #goodlife #meditacao #contemplacao #amorsemfim #omshanti #om #hathayoga #rajayoga

#boanoite 🌎 “As posturas do Yoga não são o objetivo. Tornar-se flexível não é o objetivo. Equilibrar-se sobre as mãos não é o objetivo.O objetivo é criar espaço nos lugares onde você uma vez era travado. É dissolver as camadas de proteção e defesa que você criou em torno do seu coração. É apreciar e reverenciar o seu corpo e tornar-se consciente dos seus estados mentais e do barulho produzido pela mente. É ficar em paz com quem você é. O objetivo é amar. Amar você! Vá para o seu tapetinho para sentir, não para fazer. Mude o seu foco e seu coração expandirá!” Texto de Rachel Brathen #namaste #asanas #yogabrasil #yogi #meditação #respiração #pranayama #amamosyoga #yoga #posturasyoga #gratitude #loveyoga #despertardivino #yogaday #mundozen #yogi #meditabrasil #yogini #goodvibes #yogaphoto #goodlife #meditacao #contemplacao #amorsemfim #omshanti #om #hathayoga #rajayoga - 7 hours ago

26 Likes
3 Comments
0
Gracias por hoy 🌱💚🤗
•
•
•
Por la oportunidad de compartir con ustedes un poquito de yoga, pranayama, recetas, self-care, en fin: Gracias por permitirme comunicar y compartir bienestar 😍✨

Gracias por hoy 🤗 • • • Por la oportunidad de compartir con ustedes un poquito de yoga, pranayama, recetas, self-care, en fin: Gracias por permitirme comunicar y compartir bienestar - 7 hours ago

37 Likes
8 Comments
0
💚💚💚
La natura, la nostra madre divina, il nostro vero essere è puro amore, collaborazione e rispetto reciproco di ogni cosa. ⏩seguimi per consigli sul vivere semplicemente e felicemente 😊
@bikarlasmaq 
@www.schoolofsanthi.webs.com
@https://www.facebook.com/Alghero-Yoga-Meditation-School-of-Santhi-Sardinia-582733871756459/ 📿🌍🙏
#spiritualità #alghero #Sardinia #sardegna #felicità #calma #consciousness #consapevolezza #unione #yoga #fiori #rajayoga #life #crescita #hathayoga #yogagirl #themystics #meditazione #pranayama #relax #respiro #namaste #balance #natura #pace  #ispirazione 
#gioia #vitaconsapevole #yoghiamo #poesia

La natura, la nostra madre divina, il nostro vero essere è puro amore, collaborazione e rispetto reciproco di ogni cosa. seguimi per consigli sul vivere semplicemente e felicemente @bikarlasmaq @www.schoolofsanthi.webs.com @https ://www.facebook.com/Alghero-Yoga-Meditation-School-of-Santhi-Sardinia-582733871756459/ 📿🌍 #spiritualità #alghero #Sardinia #sardegna #felicità #calma #consciousness #consapevolezza #unione #yoga #fiori #rajayoga #life #crescita #hathayoga #yogagirl #themystics #meditazione #pranayama #relax #respiro #namaste #balance #natura #pace #ispirazione #gioia #vitaconsapevole #yoghiamo #poesia - 7 hours ago

24 Likes
1 Comments
0
Starting on the 5th September.
7.30pm - 8.30pm will be a yummy yin class that will allow you to drift off to the land of 💤 ..
-
With the days becoming longer (and potentially busier), this will be the perfect session to wind down and connect to your true nature.
-
#twineyogastudio #twine #twinetime #newcastleyoga #newcastle #yogateacher #newcastleyogastudio #adamstown #adamstownyoga #hatha #vinyasa #yin #beginnersyoga #restorative #meditation #workshops #health #breathe #energy #balance #pranayama #asana #selfcare #selflove #mindfulness #gratitude #relaxation #spring #summer #newtimetable

Starting on the 5th September. 7.30pm - 8.30pm will be a yummy yin class that will allow you to drift off to the land of .. - With the days becoming longer (and potentially busier), this will be the perfect session to wind down and connect to your true nature. - #twineyogastudio #twine #twinetime #newcastleyoga #newcastle #yogateacher #newcastleyogastudio #adamstown #adamstownyoga #hatha #vinyasa #yin #beginnersyoga #restorative #meditation #workshops #health #breathe #energy #balance #pranayama #asana #selfcare #selflove #mindfulness #gratitude #relaxation #spring #summer #newtimetable - 7 hours ago

20 Likes
0 Comments
0
...& that’s a wrap! (For now)  Led 3 workshops this summer, or rather, was led by you brilliant attendees down a realm of nurturance, vulnerability, & courage to grow.  The Connection: Partner Yoga series was designed to acknowledge the impact human relationships have on our individual makeup & to recognize that while we may have been previously exposed to less than desired interactions, you Always have a chance in the Now to redirect your story. • Thank you • to each individual that showed another human being what it felt like to feel safe, acknowledged, & worthy of time. #WEchangetheworld

...& that’s a wrap! (For now) Led 3 workshops this summer, or rather, was led by you brilliant attendees down a realm of nurturance, vulnerability, & courage to grow. The Connection: Partner Yoga series was designed to acknowledge the impact human relationships have on our individual makeup & to recognize that while we may have been previously exposed to less than desired interactions, you Always have a chance in the Now to redirect your story. • Thank you • to each individual that showed another human being what it felt like to feel safe, acknowledged, & worthy of time. #WEchangetheworld - 7 hours ago

38 Likes
1 Comments
0
Domingo de estudo e auto estudo!
Om Shanti!

#yogaintegrativa #consciênciacorporal
#ashtangayoga 
#yama #niyama #asana #pranayama #pratyahara #dharana #dhyana #samadhi #yogavidaplena #yogacruzalta #vidaplenacruzalta

Domingo de estudo e auto estudo! Om Shanti! #yogaintegrativa #consciênciacorporal #ashtangayoga #yama #niyama #asana #pranayama #pratyahara #dharana #dhyana #samadhi #yogavidaplena #yogacruzalta #vidaplenacruzalta - 8 hours ago

13 Likes
1 Comments
0
this thurs 23 Aug
pranayama workshop 
With Suzi Carson 
19h30 - 21h00
Featuring Jan Haworth:
Meditation
.
All welcome 
Bookings essential
.
#pranayama 
#ponsonbyyoga 
#fourwindsyoga 
#itsaboutrhythm
@haworthjan

this thurs 23 Aug pranayama workshop With Suzi Carson 19h30 - 21h00 Featuring Jan Haworth: Meditation . All welcome Bookings essential . #pranayama #ponsonbyyoga #fourwindsyoga #itsaboutrhythm @haworthjan - 8 hours ago

3 Likes
0 Comments
0
MOVEMENT || Putting in the work and slowly making progress. In the last few weeks I've started adding in more diverse forms of exercise... functional movement strength training, boxing.... and of course, lots of yoga. Keep your 👀 on my page... new results coming soon!
#hawtbod #hawtbox #progressnotperfection #yoga #yogaaddict #yogaeverydamnday #igyoga #yogagirl #yogateacherlife #yogisofinstagram #yogi #namaste #yogajourney #everybodybends #yogaprogress #practiceandalliscoming #myyogalife #strength #flexibility #yogadaily #yogapants #iloveyoga #yogalove #yogalife #alllove #loveandlight #meditate #meditation #pranayama #yoga365

MOVEMENT || Putting in the work and slowly making progress. In the last few weeks I've started adding in more diverse forms of exercise... functional movement strength training, boxing.... and of course, lots of yoga. Keep your on my page... new results coming soon! #hawtbod #hawtbox #progressnotperfection #yoga #yogaaddict #yogaeverydamnday #igyoga #yogagirl #yogateacherlife #yogisofinstagram #yogi #namaste #yogajourney #everybodybends #yogaprogress #practiceandalliscoming #myyogalife #strength #flexibility #yogadaily #yogapants #iloveyoga #yogalove #yogalife #alllove #loveandlight #meditate #meditation #pranayama #yoga365 - 8 hours ago

30 Likes
0 Comments
0
Strength starts within. 
Class times this week:
Mon 9.15am @pranaspaceyogarosebay 
Mon 5.30pm @CBD Yoga
Mon 7.30pm @myasana.yoga 
Tues 1.30pm @sydasana_yoga 
Tues 6pm @dharmashalabondi 
Wed 12pm @ CBD Yoga
Wed 7pm @myasana.yoga 
Thur 6am @featfitnessau 
Thur 7.10am @featfitnessau 
Thur 7.30pm @allianzstadium 
Fri 6am @dharmashalabondi 
Fri 7.15am @dharmashalabondi 
Fri 4pm @dharmashalabondi 
Fri 6.30pm @dharmashalabondi 
Sun 5.30pm @soulflow_yoga 
#cherryyoga #yoga #asana #pranayama #mudra #bandha #vinyasa #yin #meditation #mindfulness #bondi #yogalife #yogagirl #balasana #strength #core #flexibility

Strength starts within. Class times this week: Mon 9.15am @pranaspaceyogarosebay Mon 5.30pm @CBD Yoga Mon 7.30pm @myasana.yoga Tues 1.30pm @sydasana_yoga Tues 6pm @dharmashalabondi Wed 12pm @ CBD Yoga Wed 7pm @myasana.yoga Thur 6am @featfitnessau Thur 7.10am @featfitnessau Thur 7.30pm @allianzstadium Fri 6am @dharmashalabondi Fri 7.15am @dharmashalabondi Fri 4pm @dharmashalabondi Fri 6.30pm @dharmashalabondi Sun 5.30pm @soulflow_yoga #cherryyoga #yoga #asana #pranayama #mudra #bandha #vinyasa #yin #meditation #mindfulness #bondi #yogalife #yogagirl #balasana #strength #core #flexibility - 8 hours ago

21 Likes
2 Comments
0
Yoga es Conexión!! #serenayogameditatiu #ioga #cursodemilagros #ser #yogainstagram #yoga #meditacio #asana #yogasana #yogui #yoguinis #hathayoga #namaste #yogi #espiritual #espiritualidad #mudra #meditacion #yug #seryoga #yogakundalini #viniyoga #yoguis #yogabarcelona #conciencia #kundalini #pranayama #yogapose #yogavida #tantrayoga

Yoga es Conexión!! #serenayogameditatiu #ioga #cursodemilagros #ser #yogainstagram #yoga #meditacio #asana #yogasana #yogui #yoguinis #hathayoga #namaste #yogi #espiritual #espiritualidad #mudra #meditacion #yug #seryoga #yogakundalini #viniyoga #yoguis #yogabarcelona #conciencia #kundalini #pranayama #yogapose #yogavida #tantrayoga - 8 hours ago

20 Likes
0 Comments
0
😍🤗🙏 Ampliar a percepção e saborear os constantes movimentos da vida, é não somente uma arte, mas uma forma sábia de existir. 
Nossa biologia, biografia e toda a natureza, seja a matéria, seja o que nos acontece interna e externamente, fazem parte da dinâmica que transforma e se modifica o tempo todo. 
Um retiro com o propósito de inspirar a inteligência criativa e o observador , curioso e desperto, que há dentro de cada um de nós. .
.
.

Data: feriado de finados

02/11 (sexta) a 04/11 (domingo) 
Local: Espaço Natureza Arco Iris - São Roque
.
.
.

Vagas limitadas: 20 pessoas 
Inscrições e informações: retiro.impermanencia@gmail.com

Whatsapp: 11- 98321-6922
.
.
.
#retiro
#yogaealinhamento
#yoga #meditação #psicologiabudista #impermanência #flow #pranayama #respiração

🤗 Ampliar a percepção e saborear os constantes movimentos da vida, é não somente uma arte, mas uma forma sábia de existir. Nossa biologia, biografia e toda a natureza, seja a matéria, seja o que nos acontece interna e externamente, fazem parte da dinâmica que transforma e se modifica o tempo todo. Um retiro com o propósito de inspirar a inteligência criativa e o observador , curioso e desperto, que há dentro de cada um de nós. . . . Data: feriado de finados 02/11 (sexta) a 04/11 (domingo) Local: Espaço Natureza Arco Iris - São Roque . . . Vagas limitadas: 20 pessoas Inscrições e informações: retiro.impermanencia@gmail.com Whatsapp: 11- 98321-6922 . . . #retiro #yogaealinhamento #yoga #meditação #psicologiabudista #impermanência #flow #pranayama #respiração - 8 hours ago

34 Likes
0 Comments
0
¡Nuestros pensamientos tienen el poder de crear o destruir! 🗨️💥 Todo lo que existe es energía, nosotros y todo lo que conocemos es vibración.  Cada uno de nosotros emite una frecuencia única que es nuestra “firma energética” en el universo. 
Nuestros pensamientos y palabras tienen también una vibración y afectan directamente a nuestro cuerpo físico y al mundo que nos rodea.

Hazte conciente del gran poder que reside en tu pensamiento y en tus palabras, pues tienen el poder de crear o destruir.

#PorqueSanarEstaenMi
.
.
.
#picoftheday #photooftheday #instamood #instagood #today #yogamx #yogaeverydamnday #yogakundalini #mexico #mexicocity #today #meditacion #meditate #yogaposes #health #healthyhappylife #woman #mujer #MantraParaSanar #mantra #mantras #pranayama #video #yogainspiration #words #power #lifequotes

¡Nuestros pensamientos tienen el poder de crear o destruir! 🗨️ Todo lo que existe es energía, nosotros y todo lo que conocemos es vibración. Cada uno de nosotros emite una frecuencia única que es nuestra “firma energética” en el universo. Nuestros pensamientos y palabras tienen también una vibración y afectan directamente a nuestro cuerpo físico y al mundo que nos rodea. Hazte conciente del gran poder que reside en tu pensamiento y en tus palabras, pues tienen el poder de crear o destruir. #PorqueSanarEstaenMi . . . #picoftheday #photooftheday #instamood #instagood #today #yogamx #yogaeverydamnday #yogakundalini #mexico #mexicocity #today #meditacion #meditate #yogaposes #health #healthyhappylife #woman #mujer #MantraParaSanar #mantra #mantras #pranayama #video #yogainspiration #words #power #lifequotes - 8 hours ago

56 Likes
2 Comments
0
There is one way of breathing that is shameful and constricted. Then, there’s another way: a breath of love that takes you all the way to infinity. ~Rumi
.
I began breathing with love and wanting to stay in the pose.  Instead of fighting or playing in the pose.  This is the moment my asana became light and free.
.
#namastaygrounded #sirsasana #headstand
#pranayama #breath

There is one way of breathing that is shameful and constricted. Then, there’s another way: a breath of love that takes you all the way to infinity. ~Rumi . I began breathing with love and wanting to stay in the pose. Instead of fighting or playing in the pose. This is the moment my asana became light and free. . #namastaygrounded #sirsasana #headstand #pranayama #breath - 8 hours ago

40 Likes
7 Comments
0
Inhale...☀️ #yoga #ayurveda #ontheroad #balance #inside #love #life #mindbodysoul #sunset #sattva #surya #prana #pranayama #silence #vata #pitta #kapha #feel #suryaayurveda #aachen

Inhale...#yoga #ayurveda #ontheroad #balance #inside #love #life #mindbodysoul #sunset #sattva #surya #prana #pranayama #silence #vata #pitta #kapha #feel #suryaayurveda #aachen - 8 hours ago

22 Likes
1 Comments
0
#YogicBreathing, which consists of deep abdominal breathing, wonderfully saturates and rejuvenates the entire body with fresh oxygen, welcoming greater vitality, clarity of mind and a balanced emotional state. 🕊

#YogicBreathing , which consists of deep abdominal breathing, wonderfully saturates and rejuvenates the entire body with fresh oxygen, welcoming greater vitality, clarity of mind and a balanced emotional state. 🕊 - 8 hours ago

11 Likes
1 Comments
0
A little caffeine-free vanilla creme latte to go with some class planning☕️ Come meditate with me @openspacewim this Tuesday🧘🏻‍♀️#rosaliehurd #tentalentscookbook #yoga #wimberley #kundalini #vegan #roma #ongnamogurudevnamo #pranayama #meditate  #8pillarshc

A little caffeine-free vanilla creme latte to go with some class planning️ Come meditate with me @openspacewim this Tuesday🧘🏻‍♀️#rosaliehurd #tentalentscookbook #yoga #wimberley #kundalini #vegan #roma #ongnamogurudevnamo #pranayama #meditate #8pillarshc - 8 hours ago

26 Likes
0 Comments
0
So here’s the thing about yoga... ⠀
or should I say, the yoga industry.⠀
Most people think to be ‘good’ at Yoga, you need to be flexible. That the most advanced yogi in the room, is the one that can do the splits, hold a handstand or get their leg behind their head... ⠀
⠀
❌ ❌ ❌ ❌⠀
⠀
⠀
Nothing could be further from the truth...⠀
So you reached your goal of sticking a handstand... now what? Are you still the arsehole in the room?... then sorry, but the yoga ain’t working and you haven’t really got the point have you?... Yoga isn’t some lofty goal to be achieved. It is your inherent  birthright. YOU are Yoga. You only need to re-member who you are....⠀
Yoga means Union. Literally translated as - To Yoke. To all that you are. To all that exists. A living breathing Union with all living organisms. Yes it sounds lofty....⠀
BUT words and teachers can only point you in the direction of the lived embodied experience. ⠀
To put it simply; You are Love. Anything that inhibits that present moment awareness is not the truth of who you are. ⠀
⠀
So come back to yourself, witness yourself as love. Know more and more of yourself as unconditional love and I promise you, you will be in the practice of yoga.⠀
Love Jules xo #thisisyoga #yogaislife

So here’s the thing about yoga... ⠀ or should I say, the yoga industry.⠀ Most people think to be ‘good’ at Yoga, you need to be flexible. That the most advanced yogi in the room, is the one that can do the splits, hold a handstand or get their leg behind their head... ⠀ ⠀ ⠀ ⠀ ⠀ Nothing could be further from the truth...⠀ So you reached your goal of sticking a handstand... now what? Are you still the arsehole in the room?... then sorry, but the yoga ain’t working and you haven’t really got the point have you?... Yoga isn’t some lofty goal to be achieved. It is your inherent birthright. YOU are Yoga. You only need to re-member who you are....⠀ Yoga means Union. Literally translated as - To Yoke. To all that you are. To all that exists. A living breathing Union with all living organisms. Yes it sounds lofty....⠀ BUT words and teachers can only point you in the direction of the lived embodied experience. ⠀ To put it simply; You are Love. Anything that inhibits that present moment awareness is not the truth of who you are. ⠀ ⠀ So come back to yourself, witness yourself as love. Know more and more of yourself as unconditional love and I promise you, you will be in the practice of yoga.⠀ Love Jules xo #thisisyoga #yogaislife - 8 hours ago

51 Likes
5 Comments
0
Let’s explore inside and have a look at the interesting things we will find with a sweet YIN YOGA practice TODAY 3:30-4:45pm @tucsonyogastudio 🙏💞
.
.
.
#yinyoga #yogalove #tucsonyoga #empowertucsonyoga #thisistucson #downtowntucson #yoga #yin #inwardyinward #yogateacher #quiet #stillness #meditation #pranayama #breathing #feeling #listening #exploring #mooninsagittarius

Let’s explore inside and have a look at the interesting things we will find with a sweet YIN YOGA practice TODAY 3:30-4:45pm @tucsonyogastudio . . . #yinyoga #yogalove #tucsonyoga #empowertucsonyoga #thisistucson #downtowntucson #yoga #yin #inwardyinward #yogateacher #quiet #stillness #meditation #pranayama #breathing #feeling #listening #exploring #mooninsagittarius - 8 hours ago

21 Likes
0 Comments
0
#lake #sunday #lazy #playing #yogaeverywhere #yoga4ever #yoga #asana #life #sun #laughing #pranayama #🕉 #train #believe #neverstop #blessed

#lake #sunday #lazy #playing #yogaeverywhere #yoga4ever #yoga #asana #life #sun #laughing #pranayama #🕉 #train #believe #neverstop #blessed - 8 hours ago

25 Likes
1 Comments
0
Il percorso Yoga.
L’antico percorso yogi o chiamato Asthanga Yoga, cioè lo Yoga dalle otto membra, e’ stato disegnato come una scala composta da otto gradini che e’ necessario percorrere per giungere alla ‘Supercoscienza’.
Nessun gradino può essere saltato e a ognuno di essi corrisponde una precisa pratica: nei primi due vengono indicate le regole comportamentali da seguire nei confronti di noi stessi e degli altri, le azioni veritiere e i pensieri corretti, nonché lo studio dei testi sacri. Nel terzo gradino sono poste le Asana, particolari posture del corpo che permettono di sperimentare la molteplicità dell’essere; le pratiche del respiro, Pranayama, sono poste nel quarto scalino, cioè a metà del percorso yogico. Solo dopo aver vissuto appieno il controllo delle energie vitali attraverso il respiro e’ possibile proseguire il cammino e salire gli ultimi tre scalini, che prevedono, nell’ordine, distacco dalla realtà esterna, concentrazione e meditazione, per giungere infine alla metà prefissa. 🙏 #Yoga #asthangayoga #meditazione #pranayama #mantra

Il percorso Yoga. L’antico percorso yogi o chiamato Asthanga Yoga, cioè lo Yoga dalle otto membra, e’ stato disegnato come una scala composta da otto gradini che e’ necessario percorrere per giungere alla ‘Supercoscienza’. Nessun gradino può essere saltato e a ognuno di essi corrisponde una precisa pratica: nei primi due vengono indicate le regole comportamentali da seguire nei confronti di noi stessi e degli altri, le azioni veritiere e i pensieri corretti, nonché lo studio dei testi sacri. Nel terzo gradino sono poste le Asana, particolari posture del corpo che permettono di sperimentare la molteplicità dell’essere; le pratiche del respiro, Pranayama, sono poste nel quarto scalino, cioè a metà del percorso yogico. Solo dopo aver vissuto appieno il controllo delle energie vitali attraverso il respiro e’ possibile proseguire il cammino e salire gli ultimi tre scalini, che prevedono, nell’ordine, distacco dalla realtà esterna, concentrazione e meditazione, per giungere infine alla metà prefissa. #Yoga #asthangayoga #meditazione #pranayama #mantra - 9 hours ago

15 Likes
1 Comments
0
Mind the breath. 
You cannot only inhale, for when you are full there will be no room for more. 
You cannot only exhale, for when you are empty there will be nothing left to give.
Inhale. Exhale. And repeat. 
Breathe deeply, in every way possible.

Mind the breath. You cannot only inhale, for when you are full there will be no room for more. You cannot only exhale, for when you are empty there will be nothing left to give. Inhale. Exhale. And repeat. Breathe deeply, in every way possible. - 9 hours ago

81 Likes
4 Comments
0
Be the person you want to be with. ॐ

@ana_salgado_s
YogaMe
Yoga for Everyone 💚 🧘🏻 🙏🏻
.
.
.
.
.
.
.
.
.
.
.
#vedas #upanishad #hindu #health # #thirdeye #bliss #joy #life #awareness #meditation #pranayama #happiness #contentment #breath #peace #stillness #shiva
#shakti #om #ॐ #soul #yogini #yoga #love #enlightenment #india #yogi hathayoga #namaste #aum #bagavadgita #

Be the person you want to be with. ॐ @ana_salgado_s YogaMe Yoga for Everyone 🧘🏻 🏻 . . . . . . . . . . . #vedas #upanishad #hindu #health # #thirdeye #bliss #joy #life #awareness #meditation #pranayama #happiness #contentment #breath #peace #stillness #shiva #shakti #om #ॐ #soul #yogini #yoga #love #enlightenment #india #yogi hathayoga #namaste #aum #bagavadgita # - 9 hours ago

14 Likes
0 Comments
0
In this very breath that we now take lies the secret that all great teachers try to tell us. ~Peter Matthiessen
.
I hold you in my hands. Your heart, your soul, your truth. Not to claim, but to honor, to witness. I hold space for others as they heal themselves with Spirit as the guide. This is my purpose and my calling. What is yours?
Big Love & Radiant Blessings!
🙏🏻💜
.
.
.
.
.
.
.
.
#healer #reiki #wellness #reikimaster #usui #holyfire #breathe #wisdomoftheday #breathwork #radiancerealized #meditation #spirituality #wakingup #thriving #thirdeye #healinghands #heartchakra #inspirationalquotes #vegan #dreamcatchers #streams #pranayama #remotehealing #yogagirl #earthmama #moongoddess #ancestral #freedom #supersoulsunday

In this very breath that we now take lies the secret that all great teachers try to tell us. ~Peter Matthiessen . I hold you in my hands. Your heart, your soul, your truth. Not to claim, but to honor, to witness. I hold space for others as they heal themselves with Spirit as the guide. This is my purpose and my calling. What is yours? Big Love & Radiant Blessings! 🏻 . . . . . . . . #healer #reiki #wellness #reikimaster #usui #holyfire #breathe #wisdomoftheday #breathwork #radiancerealized #meditation #spirituality #wakingup #thriving #thirdeye #healinghands #heartchakra #inspirationalquotes #vegan #dreamcatchers #streams #pranayama #remotehealing #yogagirl #earthmama #moongoddess #ancestral #freedom #supersoulsunday - 9 hours ago

51 Likes
10 Comments
0
Module 1 of Seasonal Yoga Teacher Training in the bag! A huge thank you to our 13 awesome students, so open and ready to learn. Can’t wait til we’re together again! And to @karennaismith7 @yogipamyoga @thestillbeneath & Lisa for helping to make this weekend such a great experience. Til the next time 🙏🏻 #seasonalyogateachertraining #seasonalyogahamilton #yogateachertraining #practiceandalliscoming #pranayogastudiohamilton #pranayama #meditation #asana #yoganidra

Module 1 of Seasonal Yoga Teacher Training in the bag! A huge thank you to our 13 awesome students, so open and ready to learn. Can’t wait til we’re together again! And to @karennaismith7 @yogipamyoga @thestillbeneath & Lisa for helping to make this weekend such a great experience. Til the next time 🏻 #seasonalyogateachertraining #seasonalyogahamilton #yogateachertraining #practiceandalliscoming #pranayogastudiohamilton #pranayama #meditation #asana #yoganidra - 9 hours ago

34 Likes
0 Comments
0
Balance is not something you find. It is something you create. It’s learning when to hold on, when to let go. It’s a constant practice. When you feel unbalanced breath deeper and reach higher. Trust bay beyond your edge there is a great gift and new feeling of freedom that awaits you. 🧘‍♀️ 🌊 ☀️ #forearmbalance #yoga #balancedlife #theartistsdaughter #yogi #yogateacher #perspective #higherconsciousness #lifeisanadventure #goforit #justdoit #fortitude #guruwithin #ryt1000 #achievement #nextlevel #lightworker💫

Balance is not something you find. It is something you create. It’s learning when to hold on, when to let go. It’s a constant practice. When you feel unbalanced breath deeper and reach higher. Trust bay beyond your edge there is a great gift and new feeling of freedom that awaits you. 🧘‍♀️ #forearmbalance #yoga #balancedlife #theartistsdaughter #yogi #yogateacher #perspective #higherconsciousness #lifeisanadventure #goforit #justdoit #fortitude #guruwithin #ryt1000 #achievement #nextlevel #lightworker - 9 hours ago

31 Likes
1 Comments
0
Desde la antigüedad los yoguis  dieron cuenta de la necesidad de limpiar🛁 el cuerpo por fuera y dentro. Es por ello, que para ayudar a liberarse de toxinas y mantener el cuerpo sano desarrollaron diferentes técnicas para depurar 🌊el cuerpo y también la mente. Estas técnicas tienen un gran valor para nosotros, hoy en día, dado que son prácticas sencillas que ayudan, entre otras cosas, a: 🌻respirar mejor (ya que mitigamos las secreciones de los conductos y vias respiratorias) 🌻aclarar la visión, 🌻aumentar nuestra absorción de alimentos
🌻disminuir alergias 🤧y síntomas de resfrío 🤒 :::::Si ya sos practicante de #yoga estas técnicas te ayudarán a profundizar la práctica de #pranayama :::: En los textos📚 clásicos de Hatha Yoga se advierte que estas técnicas deben ser transmitidas por una persona experimentada. Si bien son prácticas simples hay advertencias y consideraciones a tener en cuenta en función de las características del practicante.

Se explicará con detalle prácticas para la limpieza de nariz👃, boca👄, lengua👅, paladar, dientes, encías y ojos👀

Tambien estará a la venta los elementos para facilitar esta práctica.
Lotas y raspadores de lengua.

Los esperamos! 
Sabado 15 de Septiembre  de 15 a 18 30 hs. 
Zona La Lucila, Vte Lopez

Ale Sasso 🌸🔽
Instructora de Hatha Yoga , experiencia docente 10 años

Yoga mucho mas que asanas

#ahorayoga #yogalalucila #ahorayogaay #yoga #hathayoga #practica

Desde la antigüedad los yoguis dieron cuenta de la necesidad de limpiar🛁 el cuerpo por fuera y dentro. Es por ello, que para ayudar a liberarse de toxinas y mantener el cuerpo sano desarrollaron diferentes técnicas para depurar el cuerpo y también la mente. Estas técnicas tienen un gran valor para nosotros, hoy en día, dado que son prácticas sencillas que ayudan, entre otras cosas, a: respirar mejor (ya que mitigamos las secreciones de los conductos y vias respiratorias) aclarar la visión, aumentar nuestra absorción de alimentos disminuir alergias 🤧y síntomas de resfrío 🤒 :::::Si ya sos practicante de #yoga estas técnicas te ayudarán a profundizar la práctica de #pranayama :::: En los textos clásicos de Hatha Yoga se advierte que estas técnicas deben ser transmitidas por una persona experimentada. Si bien son prácticas simples hay advertencias y consideraciones a tener en cuenta en función de las características del practicante. Se explicará con detalle prácticas para la limpieza de nariz, boca, lengua, paladar, dientes, encías y ojos Tambien estará a la venta los elementos para facilitar esta práctica. Lotas y raspadores de lengua. Los esperamos! Sabado 15 de Septiembre de 15 a 18 30 hs. Zona La Lucila, Vte Lopez Ale Sasso Instructora de Hatha Yoga , experiencia docente 10 años Yoga mucho mas que asanas #ahorayoga #yogalalucila #ahorayogaay #yoga #hathayoga #practica - 9 hours ago

7 Likes
1 Comments
0
Awesome @goodvibesstudios #yoga teacher trainees after an intense weekend 5. We explored creative transitions and we delved deeper into the craft of planning a class intelligently. Phew! Big love to you all and see you very soon! ❤️ We are taking registration for 2019 please apply on the @goodvibesstudios website. 
#yogalondon #yogateachertraining #200hryogateacher #mindfulyoga #vinyasaflow #glowyoga #yogaclass #yogalifestyle #powertothepeaceful #yogaforall #moveforyourmind
#mobility #flexibility #fascia #pranayama #relax #restore #healyourself #deepbreathing
#yoganidra #breathe #justbreathe #stressrelief #mindfulness #breathing

Awesome @goodvibesstudios #yoga teacher trainees after an intense weekend 5. We explored creative transitions and we delved deeper into the craft of planning a class intelligently. Phew! Big love to you all and see you very soon! ️ We are taking registration for 2019 please apply on the @goodvibesstudios website. #yogalondon #yogateachertraining #200hryogateacher #mindfulyoga #vinyasaflow #glowyoga #yogaclass #yogalifestyle #powertothepeaceful #yogaforall #moveforyourmind #mobility #flexibility #fascia #pranayama #relax #restore #healyourself #deepbreathing #yoganidra #breathe #justbreathe #stressrelief #mindfulness #breathing - 9 hours ago

11 Likes
2 Comments
0
.
• Releasing the diaphragm •
.
Similar to any other muscle the diaphragm’s movement can be restricted due to weakness as well as tightness in the area that surrounds it.
.
In this series of 🎥s I demonstrate some basic stretches that will allow the release of the diaphragm. Anyone with good mobility in the thoracic part of the spine & the shoulder joint will not benefit much of this while those with a kyphosis or tight shoulders, lats & traps I think will find this sequence useful.
.
The full 🎥 is available on YouTube: https://bit.ly/2nRmcyM
.
On the 16th of Sep at @londoncryo Cryo Yoga Workshop I will cover how certain yoga poses combined with breathwork can strengthen our respiratory function.
.
ps: while I have not scheduled any workshops that will be exclusively on breathing, in most workshops I teach I touch upon the relevance of breathing in the topic covered.
.
You can find more info for all workshops on Facebook: @the.nutritionist.yogi /events/
.

. • Releasing the diaphragm • . Similar to any other muscle the diaphragm’s movement can be restricted due to weakness as well as tightness in the area that surrounds it. . In this series of s I demonstrate some basic stretches that will allow the release of the diaphragm. Anyone with good mobility in the thoracic part of the spine & the shoulder joint will not benefit much of this while those with a kyphosis or tight shoulders, lats & traps I think will find this sequence useful. . The full is available on YouTube: https://bit.ly/2nRmcyM . On the 16th of Sep at @londoncryo Cryo Yoga Workshop I will cover how certain yoga poses combined with breathwork can strengthen our respiratory function. . ps: while I have not scheduled any workshops that will be exclusively on breathing, in most workshops I teach I touch upon the relevance of breathing in the topic covered. . You can find more info for all workshops on Facebook: @the.nutritionist.yogi /events/ . - 10 hours ago

26 Likes
1 Comments
0
- Life is 10% what happens to you and 90% how you react to it.
-
#pranayama
- 
#selftaughtyogi #preservenature #gyanmudra #nature #yogi #yogini #asana #pranayama #yoga #satchitananda #utthitahastapadangusthasana #utthita #asta #padangusthasana #tree #spirit #flowofenergy #awareness #dvandva
-
#focus #photography #balance #yogalove #motivation #yogatime #yogaeverywhere #positivevibes #meditation #namaste #enlightenment0

- Life is 10% what happens to you and 90% how you react to it. - #pranayama - #selftaughtyogi #preservenature #gyanmudra #nature #yogi #yogini #asana #pranayama #yoga #satchitananda #utthitahastapadangusthasana #utthita #asta #padangusthasana #tree #spirit #flowofenergy #awareness #dvandva - #focus #photography #balance #yogalove #motivation #yogatime #yogaeverywhere #positivevibes #meditation #namaste #enlightenment0 - 10 hours ago

97 Likes
6 Comments
0
Healthy habits!🦋
:::::
#yoga#hanumanasana#sardegna#spaccata#strenght#abs#health#healthylifestyle#practice#pranayama#asana#lovetraining#me#dance#resistance#meditation#balance#strengh#body#peace#love#summer#peaceofmind#training#balance#fitness#fitnesswomen#italy#

Healthy habits!🦋 ::::: #yoga #hanumanasana #sardegna #spaccata #strenght #abs #health #healthylifestyle #practice #pranayama #asana #lovetraining #me #dance #resistance #meditation #balance #strengh #body #peace #love #summer #peaceofmind #training #balance #fitness #fitnesswomen #italy # - 2 days ago

443 Likes
13 Comments
0
Yoga for BJJ - Workshop le WE du 02/09 @graciebarraparis @graciebarra #graciebarra #bjj #yoga #meditation #pranayama

Yoga for BJJ - Workshop le WE du 02/09 @graciebarraparis @graciebarra #graciebarra #bjj #yoga #meditation #pranayama - 4 days ago

52 Likes
10 Comments
0
Working on my core.
15 seconds for every change.
Repeating all the sequence for three time with 1 minute interval.
:::::
#yoga#yogavideo#sardegna#sunshine#strenght#abs#health#healthylifestyle#practice#pranayama#asana#lovetraining#me#dance#resistance#meditation#balance#strengh#body#peace#love#summer#peaceofmind#training#balance#fitness#fitnesswomen#italy

Working on my core. 15 seconds for every change. Repeating all the sequence for three time with 1 minute interval. ::::: #yoga #yogavideo #sardegna #sunshine #strenght #abs #health #healthylifestyle #practice #pranayama #asana #lovetraining #me #dance #resistance #meditation #balance #strengh #body #peace #love #summer #peaceofmind #training #balance #fitness #fitnesswomen #italy - 19 days ago

542 Likes
26 Comments
0
It's a chance occurrence of light and shadow.
:::::
#yoga#spaccata#strenght#abs#health#healthylifestyle#practice#pranayama#asana#lovetraining#me#dance#resistance#meditation#balance#strengh#body#peace#love#summer#peaceofmind#training#balance#fitness#fitnesswomen#italy#

It's a chance occurrence of light and shadow. ::::: #yoga #spaccata #strenght #abs #health #healthylifestyle #practice #pranayama #asana #lovetraining #me #dance #resistance #meditation #balance #strengh #body #peace #love #summer #peaceofmind #training #balance #fitness #fitnesswomen #italy # - 26 days ago

892 Likes
37 Comments
0
#freeyourmind  #endlessenergy  #sensitivehands  #chakren #spirit #freedom #love #loveyourself #pranayoga #yoga #thailand #love #prana #pranayama #pranayam #meditation #pranaflow #pranachai #pranashama #pranava #pranaontribe #beach #pranav #pranatal #bangkok #yogateacher #travel #yogalife #asana

#freeyourmind #endlessenergy #sensitivehands #chakren #spirit #freedom #love #loveyourself #pranayoga #yoga #thailand #love #prana #pranayama #pranayam #meditation #pranaflow #pranachai #pranashama #pranava #pranaontribe #beach #pranav #pranatal #bangkok #yogateacher #travel #yogalife #asana - 4 months ago

28 Likes
1 Comments
0
Loading...
Load more posts
2017 - © Deskgram. All rights reserved.